Lineage for d1mkab_ (1mka B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901881Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1901882Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 1901883Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 1901885Domain d1mkab_: 1mka B: [38544]
    CASP1
    complexed with dac

Details for d1mkab_

PDB Entry: 1mka (more details), 2 Å

PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine
PDB Compounds: (B:) beta-hydroxydecanoyl thiol ester dehydrase

SCOPe Domain Sequences for d1mkab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkab_ d.38.1.2 (B:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOPe Domain Coordinates for d1mkab_:

Click to download the PDB-style file with coordinates for d1mkab_.
(The format of our PDB-style files is described here.)

Timeline for d1mkab_: