Lineage for d1mkab_ (1mka B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31742Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
  4. 31743Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (3 families) (S)
  5. 31748Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (1 protein)
  6. 31749Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 31750Species Escherichia coli [TaxId:562] [54643] (2 PDB entries)
  8. 31752Domain d1mkab_: 1mka B: [38544]

Details for d1mkab_

PDB Entry: 1mka (more details), 2 Å

PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine

SCOP Domain Sequences for d1mkab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkab_ d.38.1.2 (B:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOP Domain Coordinates for d1mkab_:

Click to download the PDB-style file with coordinates for d1mkab_.
(The format of our PDB-style files is described here.)

Timeline for d1mkab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mkaa_