Lineage for d1mkab_ (1mka B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (3 families) 
Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (1 protein) Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species) Species Escherichia coli [TaxId:562] [54643] (2 PDB entries) 
Domain d1mkab_: 1mka B: [38544]
Details for d1mkab_
PDB Entry: 1mka (more details), 2 Å
PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine
SCOP Domain Sequences for d1mkab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mkab_ d.38.1.2 (B:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf
SCOP Domain Coordinates for d1mkab_:
Click to download the PDB-style file with coordinates for d1mkab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mkab_:
- d1mkab_ appears in SCOP 1.57
- d1mkab_ appears in the current release, SCOPe 2.08
View in 3D
