Lineage for d6m10b_ (6m10 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306312Species Pseudomonas aeruginosa [TaxId:208964] [385403] (1 PDB entry)
  8. 2306314Domain d6m10b_: 6m10 B: [385439]
    automated match to d3fisa_

Details for d6m10b_

PDB Entry: 6m10 (more details), 2.99 Å

PDB Description: crystal structure of pa4853 (fis) from pseudomonas aeruginosa
PDB Compounds: (B:) Putative Fis-like DNA-binding protein

SCOPe Domain Sequences for d6m10b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m10b_ a.4.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ttptqegqtlrdsvekalhnyfahlegqpvtdvynmvlceveaplletvmnhvkgnqtka
sellglnrgtlrkklkqydl

SCOPe Domain Coordinates for d6m10b_:

Click to download the PDB-style file with coordinates for d6m10b_.
(The format of our PDB-style files is described here.)

Timeline for d6m10b_: