Lineage for d1mkaa_ (1mka A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327792Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 327793Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 327807Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (1 protein)
    contains two additional beta-strands in the N-terminal extension
  6. 327808Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 327809Species Escherichia coli [TaxId:562] [54643] (2 PDB entries)
  8. 327810Domain d1mkaa_: 1mka A: [38543]

Details for d1mkaa_

PDB Entry: 1mka (more details), 2 Å

PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine

SCOP Domain Sequences for d1mkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOP Domain Coordinates for d1mkaa_:

Click to download the PDB-style file with coordinates for d1mkaa_.
(The format of our PDB-style files is described here.)

Timeline for d1mkaa_: