SCOPe 2.03: Domain d1bvqa_: 1bvq A:

Lineage for d1bvqa_ (1bvq A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein 4-hydroxybenzoyl-CoA thioesterase [54639] (1 species)

7. Species Pseudomonas sp., CBS-3 [TaxId:306] [54640] (4 PDB entries)

8. Domain d1bvqa_: 1bvq A: [38542]
   complexed with epe

Details for d1bvqa_

PDB Entry: 1bvq, 2 Å

PDB Description: three-dimensional structure of 4-hydroxybenzoyl coa thioesterase from pseudomonas sp. strain cbs-3.

PDB Compounds: (A:) protein (4-hydroxybenzoyl coa thioesterase)

SCOPe Domain Sequences for d1bvqa_:

Sequence; same for both SEQRES and ATOM records:

>d1bvqa_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}
arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
ndgerlraievpadyielc

Timeline for d1bvqa_:

• d1bvqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvqa_ appears in SCOPe 2.02
  
• d1bvqa_ appears in SCOPe 2.04
  
• d1bvqa_ appears in the current release, SCOPe 2.08