Lineage for d1bvqa_ (1bvq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943541Protein 4-hydroxybenzoyl-CoA thioesterase [54639] (1 species)
  7. 2943542Species Pseudomonas sp., CBS-3 [TaxId:306] [54640] (4 PDB entries)
  8. 2943545Domain d1bvqa_: 1bvq A: [38542]
    complexed with epe

Details for d1bvqa_

PDB Entry: 1bvq (more details), 2 Å

PDB Description: three-dimensional structure of 4-hydroxybenzoyl coa thioesterase from pseudomonas sp. strain cbs-3.
PDB Compounds: (A:) protein (4-hydroxybenzoyl coa thioesterase)

SCOPe Domain Sequences for d1bvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvqa_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}
arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
ndgerlraievpadyielc

SCOPe Domain Coordinates for d1bvqa_:

Click to download the PDB-style file with coordinates for d1bvqa_.
(The format of our PDB-style files is described here.)

Timeline for d1bvqa_: