Lineage for d1zfja3 (1zfj A:159-220)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410626Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410627Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 410628Family d.37.1.1: CBS-domain [54632] (4 proteins)
    pairs of CBS domains dimerize to form a stable globular domain
  6. 410643Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 410663Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 410665Domain d1zfja3: 1zfj A:159-220 [38541]
    Other proteins in same PDB: d1zfja1
    complexed with imp

Details for d1zfja3

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja3 d.37.1.1 (A:159-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes}
mtsehlvtaavgtdletaerilhehrieklplvdnsgrlsglitikdiekviefphaakd
ef

SCOP Domain Coordinates for d1zfja3:

Click to download the PDB-style file with coordinates for d1zfja3.
(The format of our PDB-style files is described here.)

Timeline for d1zfja3: