Lineage for d1zfja3 (1zfj A:159-220)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79329Fold d.37: CBS-domain [54630] (1 superfamily)
  4. 79330Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 79331Family d.37.1.1: CBS-domain [54632] (1 protein)
  6. 79332Protein Type II inosine monophosphate dehydrogenase [54633] (3 species)
  7. 79339Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 79341Domain d1zfja3: 1zfj A:159-220 [38541]
    Other proteins in same PDB: d1zfja1

Details for d1zfja3

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja3 d.37.1.1 (A:159-220) Type II inosine monophosphate dehydrogenase {Streptococcus pyogenes}
mtsehlvtaavgtdletaerilhehrieklplvdnsgrlsglitikdiekviefphaakd
ef

SCOP Domain Coordinates for d1zfja3:

Click to download the PDB-style file with coordinates for d1zfja3.
(The format of our PDB-style files is described here.)

Timeline for d1zfja3: