Lineage for d1zfja2 (1zfj A:95-158)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721299Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721300Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 721301Family d.37.1.1: CBS-domain [54632] (10 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain
  6. 721353Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 721373Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 721374Domain d1zfja2: 1zfj A:95-158 [38540]
    Other proteins in same PDB: d1zfja1

Details for d1zfja2

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes
PDB Compounds: (A:) inosine monophosphate dehydrogenase

SCOP Domain Sequences for d1zfja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja2 d.37.1.1 (A:95-158) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
iseh

SCOP Domain Coordinates for d1zfja2:

Click to download the PDB-style file with coordinates for d1zfja2.
(The format of our PDB-style files is described here.)

Timeline for d1zfja2: