SCOP 1.69: Domain d1zfja2: 1zfj A:95-158

Lineage for d1zfja2 (1zfj A:95-158)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (4 proteins)
   pairs of CBS domains dimerize to form a stable globular domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)

8. Domain d1zfja2: 1zfj A:95-158 [38540]
   Other proteins in same PDB: d1zfja1

Details for d1zfja2

PDB Entry: 1zfj, 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja2:

Sequence; same for both SEQRES and ATOM records:

>d1zfja2 d.37.1.1 (A:95-158) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
iseh

Timeline for d1zfja2:

• d1zfja2 first appeared (with stable ids) in SCOP 1.55
  
• d1zfja2 appears in SCOP 1.67
  
• d1zfja2 appears in SCOP 1.71
  
• d1zfja2 last appears in SCOP 1.73