Lineage for d1zfja2 (1zfj A:95-158)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327774Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 327775Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 327776Family d.37.1.1: CBS-domain [54632] (1 protein)
  6. 327777Protein Type II inosine monophosphate dehydrogenase [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 327789Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 327790Domain d1zfja2: 1zfj A:95-158 [38540]
    Other proteins in same PDB: d1zfja1

Details for d1zfja2

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja2 d.37.1.1 (A:95-158) Type II inosine monophosphate dehydrogenase {Streptococcus pyogenes}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
iseh

SCOP Domain Coordinates for d1zfja2:

Click to download the PDB-style file with coordinates for d1zfja2.
(The format of our PDB-style files is described here.)

Timeline for d1zfja2: