Lineage for d1zfja2 (1zfj A:95-158)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31732Fold d.37: CBS-domain [54630] (1 superfamily)
  4. 31733Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 31734Family d.37.1.1: CBS-domain [54632] (1 protein)
  6. 31735Protein Type II inosine monophosphate dehydrogenase [54633] (2 species)
  7. 31739Species Streptococcus pyogenes [TaxId:1314] [54635] (1 PDB entry)
  8. 31740Domain d1zfja2: 1zfj A:95-158 [38540]
    Other proteins in same PDB: d1zfja1

Details for d1zfja2

PDB Entry: 1zfj (more details), 1.9 Å

PDB Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes

SCOP Domain Sequences for d1zfja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfja2 d.37.1.1 (A:95-158) Type II inosine monophosphate dehydrogenase {Streptococcus pyogenes}
ngviidpffltpehkvseaeelmqryrisgvpivetlanrklvgiitnrdmrfisdynap
iseh

SCOP Domain Coordinates for d1zfja2:

Click to download the PDB-style file with coordinates for d1zfja2.
(The format of our PDB-style files is described here.)

Timeline for d1zfja2: