Lineage for d6k1lc_ (6k1l C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897958Species Stenotrophomonas maltophilia [TaxId:391008] [385326] (4 PDB entries)
  8. 2897973Domain d6k1lc_: 6k1l C: [385395]
    automated match to d4mkka_
    complexed with plp, pyr; mutant

Details for d6k1lc_

PDB Entry: 6k1l (more details), 2.46 Å

PDB Description: e53a mutant of a putative cystathionine gamma-lyase
PDB Compounds: (C:) Cystathionine gamma-lyase

SCOPe Domain Sequences for d6k1lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k1lc_ c.67.1.0 (C:) automated matches {Stenotrophomonas maltophilia [TaxId: 391008]}
ralalatlaihggqspdpstgavmppiyatstyaqsspgehqgfaysrthnptrfayerc
vasleggtrgfafasgmaasstvielldagshvvamddiyggsfrlfervrrrtagldfs
fvdltdlaafeasitpktkmvwietptnpmlkivdiaavaaiakrhglivvvdntfaspm
lqrplelgadlvlhsatkylnghsdmvggmvvvgdnaelaeqmaflqnsvggvqgpfdsf
lalrglktlplrmkahcanalalaqwlekhpavekviypglashpqhelagkqmagyggi
vsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdal
vrlsvgvedlgdlqvdlgealk

SCOPe Domain Coordinates for d6k1lc_:

Click to download the PDB-style file with coordinates for d6k1lc_.
(The format of our PDB-style files is described here.)

Timeline for d6k1lc_: