Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Stenotrophomonas maltophilia [TaxId:391008] [385326] (4 PDB entries) |
Domain d6k1lc_: 6k1l C: [385395] automated match to d4mkka_ complexed with plp, pyr; mutant |
PDB Entry: 6k1l (more details), 2.46 Å
SCOPe Domain Sequences for d6k1lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k1lc_ c.67.1.0 (C:) automated matches {Stenotrophomonas maltophilia [TaxId: 391008]} ralalatlaihggqspdpstgavmppiyatstyaqsspgehqgfaysrthnptrfayerc vasleggtrgfafasgmaasstvielldagshvvamddiyggsfrlfervrrrtagldfs fvdltdlaafeasitpktkmvwietptnpmlkivdiaavaaiakrhglivvvdntfaspm lqrplelgadlvlhsatkylnghsdmvggmvvvgdnaelaeqmaflqnsvggvqgpfdsf lalrglktlplrmkahcanalalaqwlekhpavekviypglashpqhelagkqmagyggi vsivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdal vrlsvgvedlgdlqvdlgealk
Timeline for d6k1lc_: