Lineage for d6kkma2 (6kkm A:151-473)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838817Species Nostoc sp. [TaxId:103690] [385348] (2 PDB entries)
  8. 2838826Domain d6kkma2: 6kkm A:151-473 [385392]
    Other proteins in same PDB: d6kkma1, d6kkmb1, d6kkmc1, d6kkmd1
    automated match to d1ir2a1

Details for d6kkma2

PDB Entry: 6kkm (more details), 3 Å

PDB Description: crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6kkma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kkma2 c.1.14.1 (A:151-473) automated matches {Nostoc sp. [TaxId: 103690]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsa
pfqrwrdrflfvadaitkaqaetgeikghylnvtaptceemlkraeyakelkqpiimhdy
ltagftanttlarwcrdngvllhihramhavidrqknhgihfrvlakalrlsggdhihtg
tvvgklegergitmgfvdllrenyveqdksrgiyftqdwaslpgvmavasggihvwhmpa
lveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrnlaregndvireaa
kwspelavacelwkeikfefeam

SCOPe Domain Coordinates for d6kkma2:

Click to download the PDB-style file with coordinates for d6kkma2.
(The format of our PDB-style files is described here.)

Timeline for d6kkma2: