Lineage for d1b3ob3 (1b3o B:178-231)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601742Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601743Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 601744Family d.37.1.1: CBS-domain [54632] (5 proteins)
    Pfam 00571; pairs of CBS domains dimerize to form a stable globular domain
  6. 601765Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 601774Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)
  8. 601776Domain d1b3ob3: 1b3o B:178-231 [38539]
    Other proteins in same PDB: d1b3oa1, d1b3ob1
    complexed with cpr, sae

Details for d1b3ob3

PDB Entry: 1b3o (more details), 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

SCOP Domain Sequences for d1b3ob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ob3 d.37.1.1 (B:178-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II}
imtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

SCOP Domain Coordinates for d1b3ob3:

Click to download the PDB-style file with coordinates for d1b3ob3.
(The format of our PDB-style files is described here.)

Timeline for d1b3ob3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3oa1