SCOP 1.73: Domain d1b3ob2: 1b3o B:112-159

Lineage for d1b3ob2 (1b3o B:112-159)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (10 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)

8. Domain d1b3ob2: 1b3o B:112-159 [38538]
   Other proteins in same PDB: d1b3oa1, d1b3ob1

Details for d1b3ob2

PDB Entry: 1b3o, 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

PDB Compounds: (B:) protein (inosine monophosphate dehydrogenase 2)

SCOP Domain Sequences for d1b3ob2:

Sequence, based on SEQRES records:

>d1b3ob2 d.37.1.1 (B:112-159) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiis

Sequence, based on observed residues (ATOM records):

>d1b3ob2 d.37.1.1 (B:112-159) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdcgipitdtgrmgsrlvgiis

Timeline for d1b3ob2:

• d1b3ob2 first appeared (with stable ids) in SCOP 1.55
  
• d1b3ob2 appears in SCOP 1.71
  
• d1b3ob2 does not appear in SCOP 1.75