Lineage for d1b3ob2 (1b3o B:112-159)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31732Fold d.37: CBS-domain [54630] (1 superfamily)
  4. 31733Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 31734Family d.37.1.1: CBS-domain [54632] (1 protein)
  6. 31735Protein Type II inosine monophosphate dehydrogenase [54633] (2 species)
  7. 31736Species Human (Homo sapiens) [TaxId:9606] [54634] (1 PDB entry)
  8. 31737Domain d1b3ob2: 1b3o B:112-159 [38538]
    Other proteins in same PDB: d1b3oa1, d1b3ob1

Details for d1b3ob2

PDB Entry: 1b3o (more details), 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

SCOP Domain Sequences for d1b3ob2:

Sequence, based on SEQRES records: (download)

>d1b3ob2 d.37.1.1 (B:112-159) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens)}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiis

Sequence, based on observed residues (ATOM records): (download)

>d1b3ob2 d.37.1.1 (B:112-159) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens)}
qgfitdpvvlspkdrvrdcgipitdtgrmgsrlvgiis

SCOP Domain Coordinates for d1b3ob2:

Click to download the PDB-style file with coordinates for d1b3ob2.
(The format of our PDB-style files is described here.)

Timeline for d1b3ob2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b3oa1