SCOPe 2.07: Domain d6jz3a2: 6jz3 A:186-278

Lineage for d6jz3a2 (6jz3 A:186-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.0: automated matches [254272] (1 protein)
   not a true family

6. Protein automated matches [254633] (16 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:33038] [361247] (8 PDB entries)

8. Domain d6jz3a2: 6jz3 A:186-278 [385344]
   Other proteins in same PDB: d6jz3a1, d6jz3a3, d6jz3b1, d6jz3b3
   automated match to d5c71a2
   complexed with cn0, mrd

Details for d6jz3a2

PDB Entry: 6jz3, 1.5 Å

PDB Description: b-glucuronidase from ruminococcus gnavus in complex with uronic deoxynojirimycin

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6jz3a2:

Sequence; same for both SEQRES and ATOM records:

>d6jz3a2 b.1.4.0 (A:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt

Timeline for d6jz3a2:

• d6jz3a2 is new in SCOPe 2.07-stable
  
• d6jz3a2 appears in the current release, SCOPe 2.08