Lineage for d1eyqa_ (1eyq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943206Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2943207Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2943208Family d.36.1.1: Chalcone isomerase [54627] (2 proteins)
  6. 2943209Protein Chalcone isomerase [54628] (1 species)
  7. 2943210Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 2943211Domain d1eyqa_: 1eyq A: [38534]
    complexed with nar, so4

Details for d1eyqa_

PDB Entry: 1eyq (more details), 1.85 Å

PDB Description: Chalcone isomerase and naringenin
PDB Compounds: (A:) chalcone-flavonone isomerase 1

SCOPe Domain Sequences for d1eyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyqa_ d.36.1.1 (A:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
sitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasla
akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
ssavletmigehavspdlkrclaarlpallne

SCOPe Domain Coordinates for d1eyqa_:

Click to download the PDB-style file with coordinates for d1eyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1eyqa_: