SCOPe 2.08: Domain d6k0oa1: 6k0o A:795-895

Lineage for d6k0oa1 (6k0o A:795-895)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (3 families)

5. Family d.170.1.0: automated matches [331628] (1 protein)
   not a true family

6. Protein automated matches [331629] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [382368] (6 PDB entries)

8. Domain d6k0oa1: 6k0o A:795-895 [385325]
   Other proteins in same PDB: d6k0oa2, d6k0oa3, d6k0ob2, d6k0ob3
   automated match to d5hrja_

Details for d6k0oa1

PDB Entry: 6k0o, 1.99 Å

PDB Description: the crystal structure of human cd163-like homolog srcr8

PDB Compounds: (A:) Scavenger receptor cysteine-rich type 1 protein M160

SCOPe Domain Sequences for d6k0oa1:

Sequence; same for both SEQRES and ATOM records:

>d6k0oa1 d.170.1.0 (A:795-895) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prlvgadmpcsgrvevkhadtwrsvcdsdfslhaanvlcrelncgdaislsvgdhfgkgn
gltwaekfqcegsethlalcpivqhpedtcihsrevgvvcs

Timeline for d6k0oa1:

• d6k0oa1 first appeared in SCOPe 2.07