Lineage for d7boqa_ (7boq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462452Species Pseudomonas aeruginosa [TaxId:208964] [348264] (5 PDB entries)
  8. 2462455Domain d7boqa_: 7boq A: [385322]
    automated match to d4nekc_

Details for d7boqa_

PDB Entry: 7boq (more details), 1.7 Å

PDB Description: structure of pseudomonas aeruginosa odaa
PDB Compounds: (A:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d7boqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7boqa_ c.14.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
selirveretglltlrldrqdkknaltramysrmaealleaqadtavrvvlitggdacft
sgndildfleqppslrdspvgrfmsallefpkpviaavngpavgigttlllhcdlvfvgr
narlkmpfvnlgltpefgsslilprmlghakaaellmlgqdfsgeqaaawglanaaledg
atvlehardaarrflhlapsavveskrlmkapfieelrrviaeegdifstrlrspeaiea
lsafmhr

SCOPe Domain Coordinates for d7boqa_:

Click to download the PDB-style file with coordinates for d7boqa_.
(The format of our PDB-style files is described here.)

Timeline for d7boqa_:

  • d7boqa_ is new in SCOPe 2.07-stable
  • d7boqa_ does not appear in SCOPe 2.08

2462455
d7boqa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d7boqd_