Lineage for d1dk0a_ (1dk0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901437Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1901438Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 1901439Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 1901440Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 1901441Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries)
  8. 1901442Domain d1dk0a_: 1dk0 A: [38530]
    complexed with hem

Details for d1dk0a_

PDB Entry: 1dk0 (more details), 1.77 Å

PDB Description: crystal structure of the hemophore hasa from serratia marcescens crystal form p2(1), ph8
PDB Compounds: (A:) heme-binding protein a

SCOPe Domain Sequences for d1dk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk0a_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOPe Domain Coordinates for d1dk0a_:

Click to download the PDB-style file with coordinates for d1dk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk0a_: