Lineage for d1mb1__ (1mb1 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31707Fold d.34: DNA-binding domain of Mlu1-box binding protein MBP1 [54615] (1 superfamily)
  4. 31708Superfamily d.34.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54616] (1 family) (S)
  5. 31709Family d.34.1.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54617] (1 protein)
  6. 31710Protein DNA-binding domain of Mlu1-box binding protein MBP1 [54618] (1 species)
  7. 31711Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54619] (2 PDB entries)
  8. 31713Domain d1mb1__: 1mb1 - [38529]

Details for d1mb1__

PDB Entry: 1mb1 (more details), 2.1 Å

PDB Description: mbp1 from saccharomyces cerevisiae

SCOP Domain Sequences for d1mb1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb1__ d.34.1.1 (-) DNA-binding domain of Mlu1-box binding protein MBP1 {Baker's yeast (Saccharomyces cerevisiae)}
nqiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlket
hekvqggfgkyqgtwvplniakqlaekfsvydqlkplf

SCOP Domain Coordinates for d1mb1__:

Click to download the PDB-style file with coordinates for d1mb1__.
(The format of our PDB-style files is described here.)

Timeline for d1mb1__: