Lineage for d1mb1a_ (1mb1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167319Fold d.34: DNA-binding domain of Mlu1-box binding protein MBP1 [54615] (1 superfamily)
    beta(4)-alpha(2)-beta(2)-alpha; antiparallel sheet: order 123465
  4. 2167320Superfamily d.34.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54616] (1 family) (S)
    has some topological similarity to the "winged helix" DNA-binding domain, to B1 and B5 domains of PheRS-beta (1PYS CH B) and to methyl-CpG-binding domain
  5. 2167321Family d.34.1.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54617] (1 protein)
  6. 2167322Protein DNA-binding domain of Mlu1-box binding protein MBP1 [54618] (1 species)
  7. 2167323Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54619] (3 PDB entries)
  8. 2167325Domain d1mb1a_: 1mb1 A: [38529]

Details for d1mb1a_

PDB Entry: 1mb1 (more details), 2.1 Å

PDB Description: mbp1 from saccharomyces cerevisiae
PDB Compounds: (A:) mlu1-box binding protein

SCOPe Domain Sequences for d1mb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb1a_ d.34.1.1 (A:) DNA-binding domain of Mlu1-box binding protein MBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nqiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlket
hekvqggfgkyqgtwvplniakqlaekfsvydqlkplf

SCOPe Domain Coordinates for d1mb1a_:

Click to download the PDB-style file with coordinates for d1mb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1mb1a_: