Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries) |
Domain d6uiza1: 6uiz A:14-134 [385282] Other proteins in same PDB: d6uiza2 automated match to d2bc3b_ complexed with act, qg4 |
PDB Entry: 6uiz (more details), 1.85 Å
SCOPe Domain Sequences for d6uiza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uiza1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaqarintqwlltegtteanawastlvghdtftkv k
Timeline for d6uiza1: