SCOPe 2.08: Domain d1bm8a_: 1bm8 A:

Lineage for d1bm8a_ (1bm8 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.34: DNA-binding domain of Mlu1-box binding protein MBP1 [54615] (1 superfamily)
   beta(4)-alpha(2)-beta(2)-alpha; antiparallel sheet: order 123465

4. Superfamily d.34.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54616] (1 family)
   has some topological similarity to the "winged helix" DNA-binding domain, to B1 and B5 domains of PheRS-beta (1PYS CH B) and to methyl-CpG-binding domain

5. Family d.34.1.1: DNA-binding domain of Mlu1-box binding protein MBP1 [54617] (1 protein)

6. Protein DNA-binding domain of Mlu1-box binding protein MBP1 [54618] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54619] (3 PDB entries)

8. Domain d1bm8a_: 1bm8 A: [38528]

Details for d1bm8a_

PDB Entry: 1bm8, 1.71 Å

PDB Description: dna-binding domain of mbp1

PDB Compounds: (A:) transcription factor mbp1

SCOPe Domain Sequences for d1bm8a_:

Sequence; same for both SEQRES and ATOM records:

>d1bm8a_ d.34.1.1 (A:) DNA-binding domain of Mlu1-box binding protein MBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiysarysgvdvyefihstgsimkrkkddwvnathilkaanfakakrtrilekevlketh
ekvqggfgkyqgtwvplniakqlaekfsvydqlkplfdf

Timeline for d1bm8a_:

• d1bm8a_ first appeared (with stable ids) in SCOP 1.55, called d1bm8__
  
• d1bm8a_ appears in SCOPe 2.07