SCOPe 2.06: Domain d1fx3d_: 1fx3 D:

Lineage for d1fx3d_ (1fx3 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.33: SecB-like [54610] (1 superfamily)
   beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432

4. Superfamily d.33.1: SecB-like [54611] (3 families)

5. Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
   automatically mapped to Pfam PF02556

6. Protein Bacterial protein-export protein SecB [54613] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [54614] (2 PDB entries)

8. Domain d1fx3d_: 1fx3 D: [38527]

Details for d1fx3d_

PDB Entry: 1fx3, 2.5 Å

PDB Description: crystal structure of h. influenzae secb

PDB Compounds: (D:) protein-export protein secb

SCOPe Domain Sequences for d1fx3d_:

Sequence; same for both SEQRES and ATOM records:

>d1fx3d_ d.33.1.1 (D:) Bacterial protein-export protein SecB {Haemophilus influenzae [TaxId: 727]}
vlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvettle
dsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpaln
lspvnfdalfveymn

Timeline for d1fx3d_:

• d1fx3d_ first appeared (with stable ids) in SCOP 1.55
  
• d1fx3d_ appears in SCOPe 2.05
  
• d1fx3d_ appears in SCOPe 2.07
  
• d1fx3d_ appears in the current release, SCOPe 2.08