Lineage for d1fx3c_ (1fx3 C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31698Fold d.33: Bacterial protein-export protein SecB [54610] (1 superfamily)
  4. 31699Superfamily d.33.1: Bacterial protein-export protein SecB [54611] (1 family) (S)
  5. 31700Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein)
  6. 31701Protein Bacterial protein-export protein SecB [54613] (1 species)
  7. 31702Species Haemophilus influenzae [TaxId:727] [54614] (1 PDB entry)
  8. 31705Domain d1fx3c_: 1fx3 C: [38526]

Details for d1fx3c_

PDB Entry: 1fx3 (more details), 2.5 Å

PDB Description: crystal structure of h. influenzae secb

SCOP Domain Sequences for d1fx3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx3c_ d.33.1.1 (C:) Bacterial protein-export protein SecB {Haemophilus influenzae}
qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
lnlspvnfdalfveymnrqqae

SCOP Domain Coordinates for d1fx3c_:

Click to download the PDB-style file with coordinates for d1fx3c_.
(The format of our PDB-style files is described here.)

Timeline for d1fx3c_: