Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.33: Bacterial protein-export protein SecB [54610] (1 superfamily) |
Superfamily d.33.1: Bacterial protein-export protein SecB [54611] (1 family) |
Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein) |
Protein Bacterial protein-export protein SecB [54613] (1 species) |
Species Haemophilus influenzae [TaxId:727] [54614] (1 PDB entry) |
Domain d1fx3c_: 1fx3 C: [38526] |
PDB Entry: 1fx3 (more details), 2.5 Å
SCOP Domain Sequences for d1fx3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx3c_ d.33.1.1 (C:) Bacterial protein-export protein SecB {Haemophilus influenzae} qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa lnlspvnfdalfveymnrqqae
Timeline for d1fx3c_: