SCOPe 2.08: Domain d6us6a1: 6us6 A:14-134

Lineage for d6us6a1 (6us6 A:14-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d6us6a1: 6us6 A:14-134 [385232]
   Other proteins in same PDB: d6us6a2
   automated match to d2bc3b_
   complexed with act, qfy

Details for d6us6a1

PDB Entry: 6us6, 1.5 Å

PDB Description: artificial iron proteins: modelling the active sites in non-heme dioxygenases

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6us6a1:

Sequence; same for both SEQRES and ATOM records:

>d6us6a1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaqarintqwlltegtteanawastlvghdtftkv
k

Timeline for d6us6a1:

• d6us6a1 first appeared in SCOPe 2.07