![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry) |
![]() | Domain d1cjxd2: 1cjx D:154-356 [38523] complexed with act, emc, fe2 |
PDB Entry: 1cjx (more details), 2.4 Å
SCOP Domain Sequences for d1cjxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjxd2 d.32.1.3 (D:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens} aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg egnfkalfesierdqvrrgvlat
Timeline for d1cjxd2: