SCOP 1.55: Domain d1cjxd2: 1cjx D:154-356

Lineage for d1cjxd2 (1cjx D:154-356)

Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families)
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)
Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
Domain d1cjxd2: 1cjx D:154-356 [38523]

Details for d1cjxd2

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxd2 d.32.1.3 (D:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri
plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem
legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg
egnfkalfesierdqvrrgvlat

SCOP Domain Coordinates for d1cjxd2:

Click to download the PDB-style file with coordinates for d1cjxd2.
(The format of our PDB-style files is described here.)

Timeline for d1cjxd2: