Lineage for d1cjxc2 (1cjx C:154-356)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549597Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2549635Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2549653Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
  8. 2549659Domain d1cjxc2: 1cjx C:154-356 [38521]
    complexed with act, emc, fe2

Details for d1cjxc2

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd
PDB Compounds: (C:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1cjxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxc2 d.32.1.3 (C:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]}
aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri
plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem
legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg
egnfkalfesierdqvrrgvlat

SCOPe Domain Coordinates for d1cjxc2:

Click to download the PDB-style file with coordinates for d1cjxc2.
(The format of our PDB-style files is described here.)

Timeline for d1cjxc2: