Lineage for d6vh6b_ (6vh6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952704Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2952705Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2952706Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species)
    DNA-binding mode differs from that of E2 protein
  7. 2952707Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries)
  8. 2952709Domain d6vh6b_: 6vh6 B: [385204]
    Other proteins in same PDB: d6vh6a2
    automated match to d1vhia_
    protein/DNA complex; complexed with qx4

    has additional insertions and/or extensions that are not grouped together

Details for d6vh6b_

PDB Entry: 6vh6 (more details), 1.3 Å

PDB Description: crystal structure of epstein-barr virus nuclear antigen-1, ebna1, bound to fragment
PDB Compounds: (B:) Epstein-Barr nuclear antigen 1

SCOPe Domain Sequences for d6vh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vh6b_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]}
snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl
tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni
rvtvcsfddgvdlp

SCOPe Domain Coordinates for d6vh6b_:

Click to download the PDB-style file with coordinates for d6vh6b_.
(The format of our PDB-style files is described here.)

Timeline for d6vh6b_: