Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) |
Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins) |
Protein Epstein barr virus nuclear antigen-1 (ebna1) [54964] (2 species) DNA-binding mode differs from that of E2 protein |
Species Epstein-barr virus (strain b95-8) [TaxId:10377] [385181] (5 PDB entries) |
Domain d6vh6b_: 6vh6 B: [385204] Other proteins in same PDB: d6vh6a2 automated match to d1vhia_ protein/DNA complex; complexed with qx4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 6vh6 (more details), 1.3 Å
SCOPe Domain Sequences for d6vh6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vh6b_ d.58.8.1 (B:) Epstein barr virus nuclear antigen-1 (ebna1) {Epstein-barr virus (strain b95-8) [TaxId: 10377]} snpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrl tplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcni rvtvcsfddgvdlp
Timeline for d6vh6b_: