SCOPe 2.05: Domain d1cjxc1: 1cjx C:4-153

Lineage for d1cjxc1 (1cjx C:4-153)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/beta
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
Domain d1cjxc1: 1cjx C:4-153 [38520]
complexed with act, emc, fe2

Details for d1cjxc1

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

PDB Compounds: (C:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1cjxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxc1 d.32.1.3 (C:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

SCOPe Domain Coordinates for d1cjxc1:

Click to download the PDB-style file with coordinates for d1cjxc1.
(The format of our PDB-style files is described here.)

Timeline for d1cjxc1: