![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) |
![]() | Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry) |
![]() | Domain d1cjxc1: 1cjx C:4-153 [38520] |
PDB Entry: 1cjx (more details), 2.4 Å
SCOP Domain Sequences for d1cjxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjxc1 d.32.1.3 (C:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens} yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap lylidrfgegssiydidfvylegvernpvg
Timeline for d1cjxc1: