Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [346384] (13 PDB entries) |
Domain d6u1fb2: 6u1f B:115-319 [385196] Other proteins in same PDB: d6u1fa1, d6u1fa3, d6u1fb1, d6u1fb3 automated match to d2fb9a2 complexed with atp, cs, dal, mg |
PDB Entry: 6u1f (more details), 2.3 Å
SCOPe Domain Sequences for d6u1fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u1fb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
Timeline for d6u1fb2: