SCOP 1.57: Domain d1cjxb1: 1cjx B:4-153

Lineage for d1cjxb1 (1cjx B:4-153)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)

8. Domain d1cjxb1: 1cjx B:4-153 [38518]

Details for d1cjxb1

PDB Entry: 1cjx, 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxb1:

Sequence; same for both SEQRES and ATOM records:

>d1cjxb1 d.32.1.3 (B:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

Timeline for d1cjxb1:

• d1cjxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjxb1 appears in SCOP 1.59
  
• d1cjxb1 appears in the current release, SCOPe 2.08