Lineage for d1cjxb1 (1cjx B:4-153)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31626Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 31627Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) (S)
  5. 31662Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 31678Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)
  7. 31679Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
  8. 31682Domain d1cjxb1: 1cjx B:4-153 [38518]

Details for d1cjxb1

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxb1 d.32.1.3 (B:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

SCOP Domain Coordinates for d1cjxb1:

Click to download the PDB-style file with coordinates for d1cjxb1.
(The format of our PDB-style files is described here.)

Timeline for d1cjxb1: