SCOP 1.63: Domain d1cjxa2: 1cjx A:154-356

Lineage for d1cjxa2 (1cjx A:154-356)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)

8. Domain d1cjxa2: 1cjx A:154-356 [38517]

Details for d1cjxa2

PDB Entry: 1cjx, 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxa2:

Sequence; same for both SEQRES and ATOM records:

>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri
plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem
legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg
egnfkalfesierdqvrrgvlat

Timeline for d1cjxa2:

• d1cjxa2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjxa2 appears in SCOP 1.61
  
• d1cjxa2 appears in SCOP 1.65
  
• d1cjxa2 appears in the current release, SCOPe 2.08