Lineage for d1cjxa1 (1cjx A:4-153)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601513Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 601549Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)
  7. 601572Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
  8. 601573Domain d1cjxa1: 1cjx A:4-153 [38516]

Details for d1cjxa1

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

SCOP Domain Coordinates for d1cjxa1:

Click to download the PDB-style file with coordinates for d1cjxa1.
(The format of our PDB-style files is described here.)

Timeline for d1cjxa1: