Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries) |
Domain d6u1jc1: 6u1j C:1-114 [385140] Other proteins in same PDB: d6u1ja2, d6u1ja3, d6u1jb2, d6u1jb3, d6u1jc2, d6u1jc3, d6u1jd2, d6u1jd3 automated match to d2fb9a1 complexed with adp, dal, k, mg, po4 |
PDB Entry: 6u1j (more details), 2.2 Å
SCOPe Domain Sequences for d6u1jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u1jc1 c.30.1.0 (C:1-114) automated matches {Thermus thermophilus [TaxId: 300852]} mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d6u1jc1: