Lineage for d1mpyd1 (1mpy D:1-145)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79199Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 79200Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 79246Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins)
  6. 79272Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
  7. 79273Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
  8. 79280Domain d1mpyd1: 1mpy D:1-145 [38514]

Details for d1mpyd1

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2

SCOP Domain Sequences for d1mpyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpyd1 d.32.1.3 (D:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2}
mnkgvmrpghvqlrvldmskalehyvellgliemdrddqgrvylkawtevdkfslvlrea
depgmdfmgfkvvdedalrqlerdlmaygcaveqlpagelnscgrrvrfqapsghhfely
adkeytgkwglndvnpeawprdlkg

SCOP Domain Coordinates for d1mpyd1:

Click to download the PDB-style file with coordinates for d1mpyd1.
(The format of our PDB-style files is described here.)

Timeline for d1mpyd1: