| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries) |
| Domain d6u1ib1: 6u1i B:1-114 [385134] Other proteins in same PDB: d6u1ia2, d6u1ia3, d6u1ib2, d6u1ib3, d6u1ic2, d6u1ic3, d6u1id2, d6u1id3 automated match to d2fb9a1 complexed with adp, ds0, k, mg |
PDB Entry: 6u1i (more details), 2.3 Å
SCOPe Domain Sequences for d6u1ib1:
Sequence, based on SEQRES records: (download)
>d6u1ib1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
>d6u1ib1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltleakaapeg
ehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d6u1ib1: