SCOPe 2.08: Domain d6un8a1: 6un8 A:2-125

Lineage for d6un8a1 (6un8 A:2-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
   insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243

6. Protein automated matches [378998] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [379543] (2 PDB entries)

8. Domain d6un8a1: 6un8 A:2-125 [385125]
   Other proteins in same PDB: d6un8a2, d6un8b2
   automated match to d1knya2
   complexed with mg, nmy

Details for d6un8a1

PDB Entry: 6un8, 1.65 Å

PDB Description: wild type ant bound to neomycin

PDB Compounds: (A:) Aminoglycoside nucleotidyltransferase

SCOPe Domain Sequences for d6un8a1:

Sequence; same for both SEQRES and ATOM records:

>d6un8a1 d.218.1.1 (A:2-125) automated matches {Staphylococcus aureus [TaxId: 1280]}
ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee
aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq
taks

Timeline for d6un8a1:

• d6un8a1 first appeared in SCOPe 2.07