![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species) |
![]() | Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry) |
![]() | Domain d1mpyc1: 1mpy C:1-145 [38512] |
PDB Entry: 1mpy (more details), 2.8 Å
SCOP Domain Sequences for d1mpyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpyc1 d.32.1.3 (C:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2} mnkgvmrpghvqlrvldmskalehyvellgliemdrddqgrvylkawtevdkfslvlrea depgmdfmgfkvvdedalrqlerdlmaygcaveqlpagelnscgrrvrfqapsghhfely adkeytgkwglndvnpeawprdlkg
Timeline for d1mpyc1: