Lineage for d6un8b2 (6un8 B:126-253)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313855Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2313856Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins)
    N-terminal catalytic domain is followed by an all-alpha domain
    automatically mapped to Pfam PF07827
  6. 2313863Protein automated matches [379001] (3 species)
    not a true protein
  7. 2313884Species Staphylococcus aureus [TaxId:1280] [379545] (2 PDB entries)
  8. 2313886Domain d6un8b2: 6un8 B:126-253 [385110]
    Other proteins in same PDB: d6un8a1, d6un8b1
    automated match to d1kana1
    complexed with mg, nmy

Details for d6un8b2

PDB Entry: 6un8 (more details), 1.65 Å

PDB Description: wild type ant bound to neomycin
PDB Compounds: (B:) Aminoglycoside nucleotidyltransferase

SCOPe Domain Sequences for d6un8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6un8b2 a.24.16.1 (B:126-253) automated matches {Staphylococcus aureus [TaxId: 1280]}
veaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy
ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv
dvskripf

SCOPe Domain Coordinates for d6un8b2:

Click to download the PDB-style file with coordinates for d6un8b2.
(The format of our PDB-style files is described here.)

Timeline for d6un8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6un8b1