Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) |
Family a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domain [81592] (2 proteins) N-terminal catalytic domain is followed by an all-alpha domain automatically mapped to Pfam PF07827 |
Protein automated matches [379001] (3 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [379545] (2 PDB entries) |
Domain d6un8b2: 6un8 B:126-253 [385110] Other proteins in same PDB: d6un8a1, d6un8b1 automated match to d1kana1 complexed with mg, nmy |
PDB Entry: 6un8 (more details), 1.65 Å
SCOPe Domain Sequences for d6un8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6un8b2 a.24.16.1 (B:126-253) automated matches {Staphylococcus aureus [TaxId: 1280]} veaqtfhdaicaliveelfeyagkwrnirvqgpttflpsltvqvamagamliglhhricy ttsasvlteavkqsdlpsgydhlcqfvmsgqlsdseklleslenfwngiqewterhgyiv dvskripf
Timeline for d6un8b2: