SCOPe 2.08: Domain d6u1cb1: 6u1c B:1-114

Lineage for d6u1cb1 (6u1c B:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [346285] (10 PDB entries)

8. Domain d6u1cb1: 6u1c B:1-114 [385104]
   Other proteins in same PDB: d6u1ca2, d6u1ca3, d6u1ca4, d6u1cb2, d6u1cc2, d6u1cc3, d6u1cc4, d6u1cd2
   automated match to d2fb9a1

Details for d6u1cb1

PDB Entry: 6u1c, 2.2 Å

PDB Description: apo form of thermus thermophilus d-alanine-d-alanine ligase

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6u1cb1:

Sequence; same for both SEQRES and ATOM records:

>d6u1cb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d6u1cb1:

• d6u1cb1 first appeared in SCOPe 2.07