Lineage for d1mpyb1 (1mpy B:1-145)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900969Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1901048Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
  7. 1901049Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
  8. 1901052Domain d1mpyb1: 1mpy B:1-145 [38510]
    complexed with acn, fe2

Details for d1mpyb1

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2
PDB Compounds: (B:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d1mpyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpyb1 d.32.1.3 (B:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]}
mnkgvmrpghvqlrvldmskalehyvellgliemdrddqgrvylkawtevdkfslvlrea
depgmdfmgfkvvdedalrqlerdlmaygcaveqlpagelnscgrrvrfqapsghhfely
adkeytgkwglndvnpeawprdlkg

SCOPe Domain Coordinates for d1mpyb1:

Click to download the PDB-style file with coordinates for d1mpyb1.
(The format of our PDB-style files is described here.)

Timeline for d1mpyb1: