Lineage for d1mpya2 (1mpy A:146-307)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502320Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 502393Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
  7. 502394Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
  8. 502396Domain d1mpya2: 1mpy A:146-307 [38509]

Details for d1mpya2

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2

SCOP Domain Sequences for d1mpya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2}
maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih
hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne
vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt

SCOP Domain Coordinates for d1mpya2:

Click to download the PDB-style file with coordinates for d1mpya2.
(The format of our PDB-style files is described here.)

Timeline for d1mpya2: